SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2432_internal:A_SariMSG_c11687_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
ATP-binding_cassette_sub-family_C_member_Sur-like_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0005267 F potassium channel activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005739 C mitochondrion
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006813 P potassium ion transport
GO:0006932 P substrate-dependent cell migration, cell contraction
GO:0007165 P signal transduction
GO:0008144 F obsolete drug binding
GO:0008152 P metabolic process
GO:0008281 F sulfonylurea receptor activity
GO:0008282 C inward rectifying potassium channel
GO:0010107 P potassium ion import across plasma membrane
GO:0015459 F potassium channel regulator activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0019905 F syntaxin binding
GO:0030315 C T-tubule
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042802 F identical protein binding
GO:0055085 P transmembrane transport
RNA-seq EntryA_SariMSG_c11687_g1_i2
Sequence
(Amino Acid)
SSDLNIWMTFVQKVWPNFYIAGLLKLFSDLIAVIPPLGLGVIIHFIENPTKSSIVESQVT
IQEFLRNGYVMLCIITLALISQALLSQNSTHLVTVEGTRLKTALQAMIYDKCMRLAPW
(38 a.a.)

- SilkBase 1999-2023 -