SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2416_internal:A_SariMSG_c11653_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
uncharacterized_protein_LOC110370027_[Helicoverpa_armigera]
Ontology
GO:0001764 P neuron migration
GO:0001932 P regulation of protein phosphorylation
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005509 F calcium ion binding
GO:0005886 C plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007413 P axonal fasciculation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032880 P regulation of protein localization
GO:0036514 P dopaminergic neuron axon guidance
GO:0036515 P serotonergic neuron axon guidance
GO:0042384 P cilium assembly
RNA-seq EntryA_SariMSG_c11653_g2_i1
Sequence
(Amino Acid)
VLFRSRMTGNAFYNCEPIQVPVVTNPCLPSPCGPNSQCKEVNGQAVCTCIQGYMGSPPLC
RPECVVSSDCSPSKACSNQKCIDPCFGSCGVEAKCTVVKHNPI
(33 a.a.)

- SilkBase 1999-2023 -