SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2399_complete:A_SariMSG_c11614_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
ras-related_protein_Rab-8A_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005814 C centriole
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006904 P vesicle docking involved in exocytosis
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007409 P axonogenesis
GO:0008021 C synaptic vesicle
GO:0008152 P metabolic process
GO:0009306 P protein secretion
GO:0014069 C postsynaptic density
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0019003 F GDP binding
GO:0019901 F protein kinase binding
GO:0030030 P cell projection organization
GO:0030140 C trans-Golgi network transport vesicle
GO:0030425 C dendrite
GO:0030659 C cytoplasmic vesicle membrane
GO:0030670 C phagocytic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031489 F myosin V binding
GO:0031513 C non-motile cilium
GO:0032869 P cellular response to insulin stimulus
GO:0032880 P regulation of protein localization
GO:0036064 C ciliary basal body
GO:0042384 P cilium assembly
GO:0042593 P glucose homeostasis
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0045335 C phagocytic vesicle
GO:0046326 P positive regulation of glucose import
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0048210 P Golgi vesicle fusion to target membrane
GO:0051223 P regulation of protein transport
GO:0055037 C recycling endosome
GO:0055038 C recycling endosome membrane
GO:0061024 P membrane organization
GO:0070062 C extracellular exosome
GO:0072372 C cilium
GO:0072659 P protein localization to plasma membrane
GO:0097546 C ciliary base
RNA-seq EntryA_SariMSG_c11614_g1_i1
Sequence
(Amino Acid)
MAKTYDYLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ
IWDTAGQERFRTITTAYYRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILG
NKCDLDAKRLVSKERGEQLAVEYQIKFVETSAKDSLNVEYAFYTLARDIKAKMEKKQEAS
NPPGGRSGAHQLKANEPQRKPTSWLSRCSLL
*(69 a.a.)

- SilkBase 1999-2023 -