SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2341_internal:A_SariMSG_c11442_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_ALS2_C-terminal-like_protein_[Amyelois_transitella]
Ontology
GO:0001662 P behavioral fear response
GO:0001701 P in utero embryonic development
GO:0001726 C ruffle
GO:0001881 P receptor recycling
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005087 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005769 C early endosome
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0006979 P response to oxidative stress
GO:0007032 P endosome organization
GO:0007409 P axonogenesis
GO:0007528 P neuromuscular junction development
GO:0007626 P locomotory behavior
GO:0008104 P protein localization
GO:0008219 P cell death
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016050 P vesicle organization
GO:0016197 P endosomal transport
GO:0016601 P Rac protein signal transduction
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0030027 C lamellipodium
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030676 F guanyl-nucleotide exchange factor activity
GO:0031982 C vesicle
GO:0035022 P positive regulation of Rac protein signal transduction
GO:0035023 P regulation of Rho protein signal transduction
GO:0035249 P synaptic transmission, glutamatergic
GO:0042803 F protein homodimerization activity
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043087 P regulation of GTPase activity
GO:0043197 C dendritic spine
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043539 F protein serine/threonine kinase activator activity
GO:0043547 P positive regulation of GTPase activity
GO:0045860 P positive regulation of protein kinase activity
GO:0048812 P neuron projection morphogenesis
GO:0051036 P regulation of endosome size
GO:0071902 P positive regulation of protein serine/threonine kinase activity
RNA-seq EntryA_SariMSG_c11442_g1_i2
Sequence
(Amino Acid)
LQQLKTTFSPIEKLLVIRSTFQKMTTAVQLELGQNYLWSMDELFPVFHFVVVRARILQLG
SEIHFVEDFLEPAMHHGELGLMFTTLKVNYYQINKHPHNP
(32 a.a.)

- SilkBase 1999-2023 -