| Name | O_SariMSG2294_3prime_partial:A_SariMSG_c11340_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | hypothetical_protein_OBRU01_17786_[Operophtera_brumata] |
| Ontology |
| GO:0000981 |
F |
DNA-binding transcription factor activity, RNA polymerase II-specific |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003677 |
F |
DNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0006357 |
P |
regulation of transcription by RNA polymerase II |
| GO:0006950 |
P |
response to stress |
| GO:0007165 |
P |
signal transduction |
| GO:0008285 |
P |
negative regulation of cell population proliferation |
| GO:0046872 |
F |
metal ion binding |
| GO:0046983 |
F |
protein dimerization activity |
|
| RNA-seq Entry | A_SariMSG_c11340_g1_i1 |
Sequence
(Amino Acid) | MADKCCVPNCNTSKNDEVHLHAFPKSERRFQAWLKVINNPALIKLNKNEVMSRRRVCRKH
FETKFIRKNPTKGIRFSLTPDAYPTLFSKEEIETGTPKIKEPGSSIYICTPEHLRDHT
(38 a.a.) |
