SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2293_internal:A_SariMSG_c11331_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		rapamycin-insensitive_companion_of_mTOR_[Helicoverpa_armigera]
Ontology
GO:0001932 P regulation of protein phosphorylation
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0007275 P multicellular organism development
GO:0008047 F enzyme activator activity
GO:0009790 P embryo development
GO:0010468 P regulation of gene expression
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0030010 P establishment of cell polarity
GO:0030838 P positive regulation of actin filament polymerization
GO:0030950 P establishment or maintenance of actin cytoskeleton polarity
GO:0031295 P T cell costimulation
GO:0031532 P actin cytoskeleton reorganization
GO:0031929 P TOR signaling
GO:0031932 C TORC2 complex
GO:0032008 P positive regulation of TOR signaling
GO:0032956 P regulation of actin cytoskeleton organization
GO:0033135 P regulation of peptidyl-serine phosphorylation
GO:0042325 P regulation of phosphorylation
GO:0043022 F ribosome binding
GO:0043085 P positive regulation of catalytic activity
GO:0043087 P regulation of GTPase activity
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0050727 P regulation of inflammatory response
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051896 P regulation of protein kinase B signaling
GO:0051897 P positive regulation of protein kinase B signaling
GO:2000114 P regulation of establishment of cell polarity
RNA-seq EntryA_SariMSG_c11331_g1_i1
Sequence
(Amino Acid)
AGARARRAARPPPHLHAALAQHHRARALLNPVLPAHYKVLQYKVCTTDQEIADVKASLWA
VGSTAVTGPGLQLLVNLTSGYSEDSVLVHIVRHVKHSPVYSVRATAFYALSLIGSTYDGA
NLLADLGWLCVRHTRHDQFPLIPDETLSVHDQGIVNCFVASPDSRLNAYDAETSEHSDHT
DQSVADSSHSEHRYYTKIGSILEQSDQDVDYKSSYTDGRRDHQYHHDKTRKS
(76 a.a.)

- SilkBase 1999-2023 -