SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2229_internal:A_SariMSG_c11213_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
phosphatidylinositol_3,4,5-trisphosphate_3-phosphatase_and_dual-specificity_protein_phosphatase_PTEN_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0001931 C uropod
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006470 P protein dephosphorylation
GO:0006629 P lipid metabolic process
GO:0006935 P chemotaxis
GO:0007015 P actin filament organization
GO:0007049 P cell cycle
GO:0007188 P adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0008138 F protein tyrosine/serine/threonine phosphatase activity
GO:0008289 F lipid binding
GO:0016020 C membrane
GO:0016311 P dephosphorylation
GO:0016314 F phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0022604 P regulation of cell morphogenesis
GO:0030010 P establishment of cell polarity
GO:0030041 P actin filament polymerization
GO:0031152 P aggregation involved in sorocarp development
GO:0031254 C cell trailing edge
GO:0031272 P regulation of pseudopodium assembly
GO:0032154 C cleavage furrow
GO:0034461 P uropod retraction
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0036051 P protein localization to trailing edge
GO:0036052 P protein localization to uropod
GO:0043327 P chemotaxis to cAMP
GO:0045761 P regulation of adenylate cyclase activity
GO:0046856 P phosphatidylinositol dephosphorylation
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0048870 P cell motility
GO:0050919 P negative chemotaxis
GO:0051272 P positive regulation of cellular component movement
GO:0051285 C cell cortex of cell tip
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:1990753 C equatorial cell cortex
RNA-seq EntryA_SariMSG_c11213_g1_i1
Sequence
(Amino Acid)
YFMGVCVSCRRRDRKAPEKRSVPGPGGLAKGAAAELLPRRVGHLSTMANSMSNIKMTNPI
KGIVSKRRIRYTKHGFNLDLAYITDRLIAMGFPAEKLEGVYRNHIDEVYRFLEKMHKDHY
KIYNLCSERSYDSSKFHE
(45 a.a.)

- SilkBase 1999-2023 -