SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2219_internal:A_SariMSG_c11184_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		tyrosine-protein_phosphatase_69D_isoform_X1_[Helicoverpa_armigera]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0004728 F obsolete signal transducer, downstream of receptor, with protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005886 C plasma membrane
GO:0006470 P protein dephosphorylation
GO:0007155 P cell adhesion
GO:0007411 P axon guidance
GO:0007414 P axonal defasciculation
GO:0007415 P defasciculation of motor neuron axon
GO:0008045 P motor neuron axon guidance
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0023014 P signal transduction
GO:0030424 C axon
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0046331 P lateral inhibition
GO:0048813 P dendrite morphogenesis
GO:0097155 P fasciculation of sensory neuron axon
RNA-seq EntryA_SariMSG_c11184_g1_i1
Sequence
(Amino Acid)
KNVTWGPLSKFMANDSRNVRFNDLQPNTNYTIRLSAMTRTRRRGDEETKYCETKRAPPDH
APRPLWRKIYENDTYFFKVYLPRISERNGPLCCYRVYMIRLRPGMDSYQLPTPNNIITIS
YNNAETEL
(41 a.a.)

- SilkBase 1999-2023 -