SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2113_5prime_partial:A_SariMSG_c10914_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ras-related_GTP-binding_protein_C_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0007050 P regulation of cell cycle
GO:0007264 P small GTPase mediated signal transduction
GO:0008380 P RNA splicing
GO:0010506 P regulation of autophagy
GO:0016049 P cell growth
GO:0016236 P macroautophagy
GO:0019003 F GDP binding
GO:0032006 P regulation of TOR signaling
GO:0032008 P positive regulation of TOR signaling
GO:0034198 P cellular response to amino acid starvation
GO:0034448 C Ragulator complex
GO:0034613 P cellular protein localization
GO:0043231 C intracellular membrane-bounded organelle
GO:0046982 F protein heterodimerization activity
GO:0071230 P cellular response to amino acid stimulus
GO:1990131 C Gtr1-Gtr2 GTPase complex
RNA-seq EntryA_SariMSG_c10914_g1_i1
Sequence
(Amino Acid)
KLIPQLPTLENLLNILISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVID
ISCIYGMVDETEANTFNNQSSSLIKLNNGTVLYLREVNKFLALVCILREENFQKQGVIDY
NFLCFRDAITQVFELRNKCQNATALSRTRPDTPEPLPNGAADSTESTSDLSQPNLP
*(58 a.a.)

- SilkBase 1999-2023 -