SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2084_internal:A_SariMSG_c10843_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_glomulin-like_isoform_X1_[Amyelois_transitella]
Ontology
GO:0001570 P vasculogenesis
GO:0001843 P neural tube closure
GO:0005171 F hepatocyte growth factor receptor binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0031397 P negative regulation of protein ubiquitination
GO:0031461 C cullin-RING ubiquitin ligase complex
GO:0031462 C Cul2-RING ubiquitin ligase complex
GO:0031463 C Cul3-RING ubiquitin ligase complex
GO:0031464 C Cul4A-RING E3 ubiquitin ligase complex
GO:0031625 F ubiquitin protein ligase binding
GO:0032434 P regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0040029 P regulation of gene expression, epigenetic
GO:0042130 P negative regulation of T cell proliferation
GO:0042327 P positive regulation of phosphorylation
GO:0042692 P muscle cell differentiation
GO:0045086 P positive regulation of interleukin-2 production
GO:0050715 P positive regulation of cytokine production
GO:0055105 F ubiquitin-protein transferase inhibitor activity
GO:0072359 P circulatory system development
RNA-seq EntryA_SariMSG_c10843_g1_i1
Sequence
(Amino Acid)
LIKYIIDVANHSGIIGYAITLFKNSLNDAFKESELPDCFIGVQLISMIKKFCHLPHGAES
DIVELADQIIAVLNCLRYIVLKDKENVTGVRNYFKMIEKDYLDVLRTGLCMSKAHYEEKL
KEIEEGKTFCETKVKVSINVVGQILENMPVEKKKEVIHSALNAFHLIEGLV
(56 a.a.)

- SilkBase 1999-2023 -