SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2077_internal:A_SariMSG_c10809_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
1-phosphatidylinositol-4,5-bisphosphate_phosphodiesterase_beta-4_[Bombyx_mori]
Ontology
GO:0001580 P detection of chemical stimulus involved in sensory perception of bitter taste
GO:0002385 P mucosal immune response
GO:0004435 F phosphatidylinositol phospholipase C activity
GO:0004629 F phospholipase C activity
GO:0004871 F obsolete signal transducer activity
GO:0005096 F GTPase activator activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0006629 P lipid metabolic process
GO:0006644 P phospholipid metabolic process
GO:0006651 P diacylglycerol biosynthetic process
GO:0007165 P signal transduction
GO:0007601 P visual perception
GO:0007602 P phototransduction
GO:0007608 P sensory perception of smell
GO:0008081 F phosphoric diester hydrolase activity
GO:0008344 P adult locomotory behavior
GO:0008377 P light-induced release of internally sequestered calcium ion
GO:0008654 P phospholipid biosynthetic process
GO:0009649 P entrainment of circadian clock
GO:0016027 C inaD signaling complex
GO:0016028 C rhabdomere
GO:0016042 P lipid catabolic process
GO:0016056 P rhodopsin mediated signaling pathway
GO:0016059 P deactivation of rhodopsin mediated signaling
GO:0016787 F hydrolase activity
GO:0019722 P calcium-mediated signaling
GO:0035556 P intracellular signal transduction
GO:0043052 P thermotaxis
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0043547 P positive regulation of GTPase activity
GO:0045494 P photoreceptor cell maintenance
GO:0046488 P phosphatidylinositol metabolic process
GO:0046673 P negative regulation of compound eye retinal cell programmed cell death
GO:0050896 P response to stimulus
GO:0051482 P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway
GO:2000370 P positive regulation of clathrin-dependent endocytosis
RNA-seq EntryA_SariMSG_c10809_g1_i2
Sequence
(Amino Acid)
GFADFMDALSDPRVFKKRSEDMQQMGIEAGGPEKRVQIEEKKEEPLVFEPITVESLRQEK
GFLKTGRKQQKDLDAMRKRHAKEKMTLQKQQCTSLEKMIKGKNKDQLSN
(35 a.a.)

- SilkBase 1999-2023 -