SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2062_internal:A_SariMSG_c10722_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
Alpha-mannosidase_2_[Papilio_machaon]
Ontology
GO:0000139 C Golgi membrane
GO:0001701 P in utero embryonic development
GO:0001889 P liver development
GO:0003824 F catalytic activity
GO:0004553 F hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559 F alpha-mannosidase activity
GO:0004572 F mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity
GO:0005794 C Golgi apparatus
GO:0005801 C cis-Golgi network
GO:0005975 P carbohydrate metabolic process
GO:0006013 P mannose metabolic process
GO:0006486 P protein glycosylation
GO:0006491 P N-glycan processing
GO:0007005 P mitochondrion organization
GO:0007033 P vacuole organization
GO:0007585 P respiratory gaseous exchange by respiratory system
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0015923 F mannosidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0016799 F hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0030246 F carbohydrate binding
GO:0046872 F metal ion binding
GO:0048286 P lung alveolus development
GO:0050769 P positive regulation of neurogenesis
GO:0060042 P retina morphogenesis in camera-type eye
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariMSG_c10722_g1_i1
Sequence
(Amino Acid)
KILARQFEHHLRTSEILFSLVSNYIKQSTGHRLLSSEKRLEKSYEQLINARRNLGLFQHH
DAITGTSKSSVMYDYGTKLFTSLYHCIRLQETALTILMLP
(32 a.a.)

- SilkBase 1999-2023 -