SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2043_internal:A_SariMSG_c10617_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		scavenger_receptor_class_B_member_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0001530 F lipopolysaccharide binding
GO:0001875 F lipopolysaccharide immune receptor activity
GO:0001935 P endothelial cell proliferation
GO:0005737 C cytoplasm
GO:0005765 C lysosomal membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005901 C caveola
GO:0006707 P cholesterol catabolic process
GO:0006898 P receptor-mediated endocytosis
GO:0008035 F high-density lipoprotein particle binding
GO:0009986 C cell surface
GO:0010867 P positive regulation of triglyceride biosynthetic process
GO:0010886 P positive regulation of cholesterol storage
GO:0010899 P regulation of phosphatidylcholine catabolic process
GO:0015914 P phospholipid transport
GO:0015920 P lipopolysaccharide transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030169 F low-density lipoprotein particle binding
GO:0030301 P cholesterol transport
GO:0031663 P lipopolysaccharide-mediated signaling pathway
GO:0032497 P detection of lipopolysaccharide
GO:0033344 P cholesterol efflux
GO:0034185 F apolipoprotein binding
GO:0034186 F apolipoprotein A-I binding
GO:0034375 P high-density lipoprotein particle remodeling
GO:0034383 P low-density lipoprotein particle clearance
GO:0034384 P high-density lipoprotein particle clearance
GO:0035461 P vitamin transmembrane transport
GO:0042632 P cholesterol homeostasis
GO:0043231 C intracellular membrane-bounded organelle
GO:0043534 P blood vessel endothelial cell migration
GO:0043654 P recognition of apoptotic cell
GO:0043691 P reverse cholesterol transport
GO:0044406 P adhesion of symbiont to host
GO:0050892 P intestinal absorption
GO:0051000 P positive regulation of nitric-oxide synthase activity
GO:0070062 C extracellular exosome
GO:0070328 P triglyceride homeostasis
GO:0070506 F high-density lipoprotein particle receptor activity
GO:0070508 P cholesterol import
RNA-seq EntryA_SariMSG_c10617_g1_i1
Sequence
(Amino Acid)
SELGPYVYSEEWEKVNITDNENGTLSFHYRRTYTFQPELSIGMDDDAVVVPNIPMLSATS
QSKHAARFLRLAMASIMDILKIRPFVEVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEF
GLFYGKNGTSPDEVTMFTGATSMSLYGIIDRYNLRDKLPHWTNDKCNSIAGSDGSIFPPH
ITRNDTLEVYDKDLCRLLPLKYLRDVESAAGIEGFRFTPPEDVFANDEHNRCYCPAGPPC
APNGLFNVSLCQYDSPIMLSFPHFYLADPSLLEAVEGISPPNPEEHRLFIDVQPEMGIAM
RARARIRINLAVSQVFDIKQVANFPDRKS
(108 a.a.)

- SilkBase 1999-2023 -