SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2033_internal:A_SariMSG_c10588_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		dedicator_of_cytokinesis_protein_6-like,_partial_[Helicoverpa_armigera]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005622 C intracellular anatomical structure
GO:0005925 C focal adhesion
GO:0007264 P small GTPase mediated signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0008180 C COP9 signalosome
GO:0022027 P interkinetic nuclear migration
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030426 C growth cone
GO:0031175 P neuron projection development
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0045178 C basal part of cell
GO:0045200 P establishment of neuroblast polarity
GO:0048365 F small GTPase binding
GO:0050767 P regulation of neurogenesis
GO:0090630 P activation of GTPase activity
GO:1904754 P positive regulation of vascular associated smooth muscle cell migration
RNA-seq EntryA_SariMSG_c10588_g1_i1
Sequence
(Amino Acid)
GNIPPRIGLTNMESELRASISELPTSNVEVLARYLPVVLDKLLQLLVAPPALASHILSIA
QDVFTCLAHIFTEITNMNDGVTCDFHGRSSLISTYIQYQCTIPRPSLTDRDIGLPL
(37 a.a.)

- SilkBase 1999-2023 -