SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2012_internal:A_SariMSG_c10436_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Xanthine_dehydrogenase_[Papilio_machaon]
Ontology
GO:0003824 F catalytic activity
GO:0004854 F xanthine dehydrogenase activity
GO:0004855 F xanthine oxidase activity
GO:0005506 F iron ion binding
GO:0005777 C peroxisome
GO:0005829 C cytosol
GO:0005875 C microtubule associated complex
GO:0006144 P purine nucleobase metabolic process
GO:0006206 P pyrimidine nucleobase metabolic process
GO:0006525 P arginine metabolic process
GO:0006568 P tryptophan metabolic process
GO:0006650 P glycerophospholipid metabolic process
GO:0008340 P determination of adult lifespan
GO:0009055 F electron transfer activity
GO:0009115 P xanthine catabolic process
GO:0016491 F oxidoreductase activity
GO:0016614 F oxidoreductase activity, acting on CH-OH group of donors
GO:0016903 F oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0043546 F molybdopterin cofactor binding
GO:0045471 P response to ethanol
GO:0046872 F metal ion binding
GO:0048072 P compound eye pigmentation
GO:0050660 F flavin adenine dinucleotide binding
GO:0051536 F iron-sulfur cluster binding
GO:0051537 F 2 iron, 2 sulfur cluster binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_SariMSG_c10436_g1_i1
Sequence
(Amino Acid)
EFFTYGVTCSEVIIDCLTGDHQVLRTDIVMDVGESLNPAIDIGQIEGAFMQGYGLLTLEE
LVFSPSGETLSRGPGTYKIPAFSDIPKEFNVSLLKGAPNPRAVYSSKAIGEPPLFLAASV
FFAIKDAISSARTDGGLSP
(45 a.a.)

- SilkBase 1999-2023 -