SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1995_5prime_partial:A_SariMSG_c10350_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		inebriated_protein_[Manduca_sexta]
Ontology
GO:0005034 F osmosensor activity
GO:0005215 F transporter activity
GO:0005328 F neurotransmitter:sodium symporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0009414 P response to water deprivation
GO:0009881 F photoreceptor activity
GO:0015293 F symporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0019226 P transmission of nerve impulse
GO:0030154 P cell differentiation
GO:0042065 P glial cell growth
GO:0042066 P perineurial glial growth
GO:0047484 P regulation of response to osmotic stress
GO:0050891 P multicellular organismal water homeostasis
GO:0055085 P transmembrane transport
RNA-seq EntryA_SariMSG_c10350_g1_i1
Sequence
(Amino Acid)
HIIHSGIYIFQLMDYYAASLSVTYLAFFEVVAIAWFYGVGRLSRNIKQMTGRCPSLYFRF
CWLIASPALLLALWVASLVDYTPPSYRHYQYPAWAQALGWIIASVSLLCIPVYAVIVIIR
APGDNLKEKFRHSIRPSSICECGVNGCDICYSDSEHTDDKTAIN
*(54 a.a.)

- SilkBase 1999-2023 -