SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1968_internal:A_SariMSG_c10269_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		importin-5_[Bombyx_mori]
Ontology
GO:0000059 P obsolete protein import into nucleus, docking
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0006607 P NLS-bearing protein import into nucleus
GO:0006610 P ribosomal protein import into nucleus
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0008139 F nuclear localization sequence binding
GO:0008536 F small GTPase binding
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0031965 C nuclear membrane
GO:0034399 C nuclear periphery
GO:0042307 P positive regulation of protein import into nucleus
GO:0043231 C intracellular membrane-bounded organelle
GO:0044822 F RNA binding
GO:0071230 P cellular response to amino acid stimulus
RNA-seq EntryA_SariMSG_c10269_g1_i1
Sequence
(Amino Acid)
ACVKYQDIFLEPMLNALRESEPEVRQAAAYGCGVLAQFGGPQFAAACARAVPLLAAIISE
PDARSLEKINATENAISAVAKIIKYNHSQINRDEIITHWLTWLPVTEDTEEADRK
(37 a.a.)

- SilkBase 1999-2023 -