SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG1966_internal:A_SariMSG_c10257_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
huntingtin_[Helicoverpa_armigera]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0002039 F p53 binding
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005522 F profilin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005770 C late endosome
GO:0005776 C autophagosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005814 C centriole
GO:0005829 C cytosol
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006915 P apoptotic process
GO:0007030 P Golgi organization
GO:0007417 P central nervous system development
GO:0008134 F transcription factor binding
GO:0014069 C postsynaptic density
GO:0030136 C clathrin-coated vesicle
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030659 C cytoplasmic vesicle membrane
GO:0031587 P positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0034452 F dynactin binding
GO:0042297 P vocal learning
GO:0042802 F identical protein binding
GO:0043025 C neuronal cell body
GO:0043234 C protein-containing complex
GO:0044325 F transmembrane transporter binding
GO:0045505 F dynein intermediate chain binding
GO:0045724 P positive regulation of cilium assembly
GO:0047496 P vesicle transport along microtubule
GO:0048487 F beta-tubulin binding
GO:0048513 P animal organ development
GO:0051028 P mRNA transport
GO:0071598 C neuronal ribonucleoprotein granule
GO:2000117 P negative regulation of cysteine-type endopeptidase activity
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_SariMSG_c10257_g1_i1
Sequence
(Amino Acid)
LVGFARNLPLNGENGDTTLLKVDSLQVACVFAYCEYFVENGLSEAVHLTWLLVNRVHILV
SQYQQNIIQDLISKVQQTAGASGLLLQAIAARCQSRLKGEFALNTYKILSLCHQSQSGAL
VFLICRIVGKLEPAKAARFARL
(46 a.a.)

- SilkBase 1999-2023 -