SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1958_internal:A_SariMSG_c10200_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		CCR4-NOT_transcription_complex_subunit_6_isoform_X2_[Bombyx_mori]
Ontology
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0004535 F poly(A)-specific ribonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0006417 P regulation of translation
GO:0008284 P positive regulation of cell population proliferation
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0016787 F hydrolase activity
GO:0030014 C CCR4-NOT complex
GO:0031047 P gene silencing by RNA
GO:0046872 F metal ion binding
GO:0061157 P mRNA destabilization
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
RNA-seq EntryA_SariMSG_c10200_g1_i1
Sequence
(Amino Acid)
GWTTLEVTGGVRALAPPLFQLTHLTALYLNDNSLQRIPPDINQLANLHTLDVSNNKLRSL
PTELGDLIQLRELHLHNNYLRALPYELGRLFHLQLLGLQGNPLNKEMLSIYNDSNGTSKL
LTYMLDNLQVSATLPPQRPWIPLTR
(47 a.a.)

- SilkBase 1999-2023 -