SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG1954_internal:A_SariMSG_c10191_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
glucosylceramidase_[Papilio_xuthus]
Ontology
GO:0004348 F glucosylceramidase activity
GO:0005102 F signaling receptor binding
GO:0005615 C extracellular space
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005975 P carbohydrate metabolic process
GO:0006629 P lipid metabolic process
GO:0006665 P sphingolipid metabolic process
GO:0006680 P glucosylceramide catabolic process
GO:0008152 P metabolic process
GO:0009267 P cellular response to starvation
GO:0009268 P response to pH
GO:0016020 C membrane
GO:0016239 P positive regulation of macroautophagy
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0023021 P termination of signal transduction
GO:0032434 P regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032715 P negative regulation of interleukin-6 production
GO:0033561 P regulation of water loss via skin
GO:0033574 P response to testosterone
GO:0035307 P positive regulation of protein dephosphorylation
GO:0043202 C lysosomal lumen
GO:0043407 P negative regulation of MAP kinase activity
GO:0043589 P skin morphogenesis
GO:0043627 P response to estrogen
GO:0046512 P sphingosine biosynthetic process
GO:0046513 P ceramide biosynthetic process
GO:0051384 P response to glucocorticoid
GO:0070062 C extracellular exosome
GO:0071356 P cellular response to tumor necrosis factor
GO:0097066 P response to thyroid hormone
GO:1903052 P positive regulation of proteolysis involved in cellular protein catabolic process
RNA-seq EntryA_SariMSG_c10191_g1_i1
Sequence
(Amino Acid)
SFKASSVPVYIIGTVWSPPDWMKEKTNYSVCGRLKTRFFPTYAEYYYKFLEEYDRHGIPV
WAITTTNEPTNGFLPIKKFNCLGWSAYRMGLWISNHLGPKIRGSRFRNVKILAVDDQRYN
LPLFFNEMLEDHPIASYYIDGVA
(46 a.a.)

- SilkBase 1999-2023 -