SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1938_internal:A_SariMSG_c10117_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		TBC1_domain_family_member_5_[Helicoverpa_armigera]
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0005776 C autophagosome
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006914 P autophagy
GO:0010008 C endosome membrane
GO:0010508 P positive regulation of autophagy
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0030122 C AP-2 adaptor complex
GO:0030904 C retromer complex
GO:0031338 P regulation of vesicle fusion
GO:0031410 C cytoplasmic vesicle
GO:0035612 F AP-2 adaptor complex binding
GO:0042147 P retrograde transport, endosome to Golgi
GO:0042594 P response to starvation
GO:0090630 P activation of GTPase activity
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:1902017 P regulation of cilium assembly
GO:1990316 C Atg1/ULK1 kinase complex
RNA-seq EntryA_SariMSG_c10117_g1_i1
Sequence
(Amino Acid)
LATHLADCKISMELFGIRWLRLLFGREFPRSEVPHLWGFLFTEGPMLPDLHYVIVAMLIS
IRTTLLDRDAGVVLSALMRPACLSVGHVCALAMHLRRPLDYPRPPTPPPPAPPSLNNDLD
TINNRG
(41 a.a.)

- SilkBase 1999-2023 -