SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG13099_3prime_partial:A_SariMSG_c25556_g2_i2
Scaffold_id
NCBI non-redundant
(nr)		14_kDa_phosphohistidine_phosphatase-like_[Helicoverpa_armigera]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006470 P protein dephosphorylation
GO:0008969 F protein histidine phosphatase activity
GO:0016787 F hydrolase activity
GO:0019855 F calcium channel inhibitor activity
GO:0035971 P peptidyl-histidine dephosphorylation
GO:0044325 F transmembrane transporter binding
GO:0050860 P negative regulation of T cell receptor signaling pathway
GO:0051350 P negative regulation of lyase activity
GO:0070062 C extracellular exosome
GO:2000147 P positive regulation of cell motility
GO:2000249 P regulation of actin cytoskeleton reorganization
GO:2000984 P negative regulation of ATP citrate synthase activity
RNA-seq EntryA_SariMSG_c25556_g2_i2
Sequence
(Amino Acid)
MSMQVAVPLESIPKVEIDDNGVFKFILMKVYDKSDDERNIIILRGYHRCLYHSDIYEEVQ
EKLYPLDCDPMGGGRISHEAEAKKIHIYGYSQGYGQSDHELA
(33 a.a.)

- SilkBase 1999-2023 -