SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12930_internal:A_SariMSG_c25470_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
putative_desaturasedes2_[Spodoptera_litura]
Ontology
GO:0004768 F stearoyl-CoA 9-desaturase activity
GO:0005506 F iron ion binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0006636 P unsaturated fatty acid biosynthetic process
GO:0006641 P triglyceride metabolic process
GO:0008610 P lipid biosynthetic process
GO:0010873 P positive regulation of cholesterol esterification
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016491 F oxidoreductase activity
GO:0016717 F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0031090 C organelle membrane
GO:0032896 F palmitoyl-CoA 9-desaturase activity
GO:0033561 P regulation of water loss via skin
GO:0034434 P sterol esterification
GO:0034435 P cholesterol esterification
GO:0043231 C intracellular membrane-bounded organelle
GO:0044130 P obsolete negative regulation of growth of symbiont in host
GO:0046872 F metal ion binding
GO:0048733 P sebaceous gland development
GO:0050830 P defense response to Gram-positive bacterium
GO:0050872 P white fat cell differentiation
GO:0050873 P brown fat cell differentiation
GO:0055114 P obsolete oxidation-reduction process
GO:0070542 P response to fatty acid
GO:1903699 P tarsal gland development
GO:1903966 P monounsaturated fatty acid biosynthetic process
RNA-seq EntryA_SariMSG_c25470_g1_i1
Sequence
(Amino Acid)
FRSVQVTLHLTTIYGFYLILTNQVMILTTLFALGTIYTSGFGITAGVHRLWSHRAYKANT
PLRVILAILFTVTGQRDIYTWALDHRVHHKYSETVADPHDIRRGFWFAHVGWLVFTPHPA
VEDRRIALQKTSLDLMADPVVRLQKIFFIPLFALLNIALPVWVPYYIWNESLMNSFVVSF
VTRFTITLNIAFCVNSFAHLWGNKPYDRFIKSVENSMVSLAALGEGWHNYHHVFPWDYRT
SELGRINISTNFIDMFAKIGWAYDLKAATPSMIINR
(91 a.a.)

- SilkBase 1999-2023 -