SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12904_internal:A_SariMSG_c25450_g2_i3
Scaffold_id
NCBI non-redundant
(nr)
ubiquitin_carboxyl-terminal_hydrolase_7-like_isoform_X1_[Helicoverpa_armigera]
Ontology
GO:0002039 F p53 binding
GO:0004197 F cysteine-type endopeptidase activity
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007275 P multicellular organism development
GO:0008022 F protein C-terminus binding
GO:0008134 F transcription factor binding
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0010216 P maintenance of DNA methylation
GO:0016032 P viral process
GO:0016579 P protein deubiquitination
GO:0016604 C nuclear body
GO:0016605 C PML body
GO:0016787 F hydrolase activity
GO:0031625 F ubiquitin protein ligase binding
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0036459 F thiol-dependent deubiquitinase
GO:0050821 P protein stabilization
GO:0051090 P regulation of DNA-binding transcription factor activity
GO:1904353 P regulation of telomere capping
RNA-seq EntryA_SariMSG_c25450_g2_i3
Sequence
(Amino Acid)
DRKSVCQDYFKYIFYKVEVQFVDKTVPNDPGFTMELSMQMRYDQMARAVGHRLNVDPYLI
QFFKCQNYKDTPGLPLRYSYDGILKDLLVYCKPKCPKKLFYQILSIKVNELDNKKQFKCL
WVG
(40 a.a.)

- SilkBase 1999-2023 -