SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1286_internal:A_SariMSG_c6297_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		afadin_[Helicoverpa_armigera]
Ontology
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0017016 F small GTPase binding
GO:0021537 P telencephalon development
GO:0021987 P cerebral cortex development
GO:0030054 C cell junction
GO:0034334 P adherens junction maintenance
GO:0043547 P positive regulation of GTPase activity
GO:0045177 C apical part of cell
GO:0048854 P brain morphogenesis
GO:0048872 P homeostasis of number of cells
GO:0050839 F cell adhesion molecule binding
GO:0060019 P radial glial cell differentiation
GO:0060563 P neuroepithelial cell differentiation
GO:0070445 P regulation of oligodendrocyte progenitor proliferation
GO:0090557 P establishment of endothelial intestinal barrier
RNA-seq EntryA_SariMSG_c6297_g1_i1
Sequence
(Amino Acid)
LNGQRVVNTQRLQHDCLLKFGRVSTFRFLDPTQENIINRNLAQSQHYGSGSIYDRSPTSP
GENSGAMSPTSLASHHPDTLDSNANTTDNDYIRTMSPVSNDTYYRDSNDP
(35 a.a.)

- SilkBase 1999-2023 -