SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12846_5prime_partial:A_SariMSG_c25416_g1_i4
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_JNK-interacting_protein_3_isoform_X1_[Papilio_xuthus]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0001669 C acrosomal vesicle
GO:0005078 F MAP-kinase scaffold activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0007257 P obsolete activation of JUN kinase activity
GO:0007283 P spermatogenesis
GO:0008432 F JUN kinase binding
GO:0016021 C integral component of membrane
GO:0019894 F kinesin binding
GO:0030159 F signaling receptor complex adaptor activity
GO:0030335 P positive regulation of cell migration
GO:0031410 C cytoplasmic vesicle
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043410 P positive regulation of MAPK cascade
GO:0045666 P positive regulation of neuron differentiation
GO:0048273 F mitogen-activated protein kinase p38 binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051146 P striated muscle cell differentiation
GO:0051149 P positive regulation of muscle cell differentiation
GO:0051260 P protein homooligomerization
GO:0070062 C extracellular exosome
GO:0090074 P negative regulation of protein homodimerization activity
RNA-seq EntryA_SariMSG_c25416_g1_i4
Sequence
(Amino Acid)
RSEERRRLWIGTSNGVVISVPLSESSNTDSGSGQTVSRSNIPGHVRARSASPTGIIPWCS
MAHAQLSFHGHREAVTFFVAVPGSANTPLGTPDSPPGHQTPRRPTPVPPMLVISGGEGYI
DFRIADSELEDSVVVAEDGSSSGHSSLAERATKSHLIVWQVATA
*(54 a.a.)

- SilkBase 1999-2023 -