SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG1282_5prime_partial:A_SariMSG_c6286_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
decapentaplegic_precursor_[Danaus_plexippus_plexippus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001503 P ossification
GO:0005102 F signaling receptor binding
GO:0005125 F cytokine activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0007275 P multicellular organism development
GO:0008083 F growth factor activity
GO:0009612 P response to mechanical stimulus
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0019904 F protein domain specific binding
GO:0030154 P cell differentiation
GO:0030509 P BMP signaling pathway
GO:0031988 C vesicle
GO:0032526 P response to retinoic acid
GO:0040007 P growth
GO:0042698 P ovulation cycle
GO:0042803 F protein homodimerization activity
GO:0042981 P regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043408 P regulation of MAPK cascade
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048762 P mesenchymal cell differentiation
GO:0050769 P positive regulation of neurogenesis
GO:0051216 P cartilage development
GO:0060395 P SMAD protein signal transduction
GO:0070700 F BMP receptor binding
GO:0071260 P cellular response to mechanical stimulus
GO:0071773 P cellular response to BMP stimulus
RNA-seq EntryA_SariMSG_c6286_g1_i1
Sequence
(Amino Acid)
EAREICQRRPLYVDFAEVGWSDWIVAPHGYEAYYCQGDCPFPLADHLNGTNHAIVQTLVN
SVNPAAVPKACCVPTQLSPISMLYMDEQNQVVLKNYQDMMVMGCGCR
*(35 a.a.)

- SilkBase 1999-2023 -