SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG127_internal:A_SariMSG_c513_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
Anoctamin-6_[Papilio_machaon]
Ontology
GO:0002407 P dendritic cell chemotaxis
GO:0002543 P activation of blood coagulation via clotting cascade
GO:0005227 F calcium activated cation channel activity
GO:0005229 F intracellular calcium activated chloride channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005247 F voltage-gated chloride channel activity
GO:0005254 F chloride channel activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006821 P chloride transport
GO:0006869 P lipid transport
GO:0007596 P blood coagulation
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017121 P plasma membrane phospholipid scrambling
GO:0017128 F phospholipid scramblase activity
GO:0030501 P positive regulation of bone mineralization
GO:0032060 P bleb assembly
GO:0034220 P ion transmembrane transport
GO:0034707 C chloride channel complex
GO:0034765 P regulation of ion transmembrane transport
GO:0034767 P positive regulation of ion transmembrane transport
GO:0035590 P purinergic nucleotide receptor signaling pathway
GO:0035630 P bone mineralization involved in bone maturation
GO:0035725 P sodium ion transmembrane transport
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0045794 P negative regulation of cell volume
GO:0046931 P pore complex assembly
GO:0046983 F protein dimerization activity
GO:0060100 P positive regulation of phagocytosis, engulfment
GO:0061588 P calcium activated phospholipid scrambling
GO:0061589 P calcium activated phosphatidylserine scrambling
GO:0061590 P calcium activated phosphatidylcholine scrambling
GO:0061591 P calcium activated galactosylceramide scrambling
GO:0070062 C extracellular exosome
GO:0070588 P calcium ion transmembrane transport
GO:0090026 P positive regulation of monocyte chemotaxis
GO:0097045 P phosphatidylserine exposure on blood platelet
GO:1902304 P positive regulation of potassium ion export across plasma membrane
GO:1902476 P chloride transmembrane transport
GO:1903959 P regulation of anion transmembrane transport
GO:2000353 P positive regulation of endothelial cell apoptotic process
RNA-seq EntryA_SariMSG_c513_g1_i1
Sequence
(Amino Acid)
RDNGSETSTRAAEECGCGVSSPTQPIGSNGDAKPKTNHCSIIMGGVLNNPSLTFNDGVRS
IDYVLVWESEKEDTNNPEAHERRRVFEENLKIDGLQLELDQPKGLYGLNFVKIHAPFQVL
RDYSEI
(41 a.a.)

- SilkBase 1999-2023 -