SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12770_internal:A_SariMSG_c25375_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_vacuolar_protein_sorting-associated_protein_18_homolog_[Papilio_machaon]
Ontology
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006904 P vesicle docking involved in exocytosis
GO:0007032 P endosome organization
GO:0007040 P lysosome organization
GO:0007275 P multicellular organism development
GO:0007634 P optokinetic behavior
GO:0008333 P endosome to lysosome transport
GO:0015031 P protein transport
GO:0015721 P bile acid and bile salt transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030674 F protein-macromolecule adaptor activity
GO:0030897 C HOPS complex
GO:0031902 C late endosome membrane
GO:0035542 P regulation of SNARE complex assembly
GO:0043485 P endosome to pigment granule transport
GO:0045176 P apical protein localization
GO:0046872 F metal ion binding
GO:0048069 P eye pigmentation
GO:0048757 P pigment granule maturation
GO:0060036 P notochord cell vacuolation
RNA-seq EntryA_SariMSG_c25375_g1_i2
Sequence
(Amino Acid)
DRKSVVASTTKYFIFVTTPTRLYQFIGHAIFSDDKPSLQSVFYSYLTIPETGFQEIPSTL
KYSKLQFFFDKNNMPKTFAWLTEPGIFYGQLDPTSQQNSNSLVTQGRS
(35 a.a.)

- SilkBase 1999-2023 -