SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12766_internal:A_SariMSG_c25371_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ubiquitin-like_modifier-activating_enzyme_ATG7_[Bombyx_mori]
Ontology
GO:0000045 P autophagosome assembly
GO:0000407 C phagophore assembly site
GO:0000422 P autophagy of mitochondrion
GO:0001889 P liver development
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005930 C axoneme
GO:0006497 P protein lipidation
GO:0006501 P C-terminal protein lipidation
GO:0006520 P cellular amino acid metabolic process
GO:0006810 P transport
GO:0006914 P autophagy
GO:0006995 P cellular response to nitrogen starvation
GO:0006996 P organelle organization
GO:0007005 P mitochondrion organization
GO:0007628 P adult walking behavior
GO:0008134 F transcription factor binding
GO:0008641 F ubiquitin-like modifier activating enzyme activity
GO:0009267 P cellular response to starvation
GO:0009791 P post-embryonic development
GO:0010508 P positive regulation of autophagy
GO:0015031 P protein transport
GO:0016236 P macroautophagy
GO:0016239 P positive regulation of macroautophagy
GO:0019725 P cellular homeostasis
GO:0019778 F Atg12 activating enzyme activity
GO:0019779 F Atg8 activating enzyme activity
GO:0021680 P cerebellar Purkinje cell layer development
GO:0021860 P pyramidal neuron development
GO:0021955 P central nervous system neuron axonogenesis
GO:0021987 P cerebral cortex development
GO:0030163 P protein catabolic process
GO:0031175 P neuron projection development
GO:0031396 P regulation of protein ubiquitination
GO:0031401 P positive regulation of protein modification process
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032446 P protein modification by small protein conjugation
GO:0034614 P cellular response to reactive oxygen species
GO:0034727 P piecemeal microautophagy of the nucleus
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0039521 P suppression by virus of host autophagy
GO:0039689 P negative stranded viral RNA replication
GO:0042594 P response to starvation
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0044805 P late nucleophagy
GO:0045732 P positive regulation of protein catabolic process
GO:0050765 P negative regulation of phagocytosis
GO:0050877 P nervous system process
GO:0051607 P defense response to virus
GO:0055013 P cardiac muscle cell development
GO:0060284 P regulation of cell development
GO:0060548 P negative regulation of cell death
GO:0061024 P membrane organization
GO:0070257 P positive regulation of mucus secretion
GO:0071455 P cellular response to hyperoxia
GO:0090156 P cellular sphingolipid homeostasis
GO:0090157 P negative regulation of sphingolipid biosynthetic process
GO:1903146 P regulation of autophagy of mitochondrion
GO:1903706 P regulation of hemopoiesis
GO:2000619 P negative regulation of histone H4-K16 acetylation
RNA-seq EntryA_SariMSG_c25371_g1_i1
Sequence
(Amino Acid)
AIKNKDNLIVRKLSEILKADSINHSELNIDLTRTYFVFTDPSNGKNPGWPLRTFLAALLQ
HCSGLVNSNLQVIGIRCGVNGSIDNSIVLNIKIPQNVQIVESAGWVGWERNDKGNFGPKL
ANMSASMDPMILADTSSDLNIKLMKWRLVPDIDVEVMKATKCLLLGAGTLGCHVARDLLA
WGFRHITFIDNGKVSYSNPTRQVLFSYQDCLGGGRKKAVAAADNLRLILPTVKSKGIAAH
IPMPGHPVGESLKQETVENINLITKEISNHDVIFLLLDTREARWLPTLIAAHYGKILINA
ALGFDSYLVMRHGIATMEDSDTSLNDSSIPGTQLGCYFCNDVTAPGNSLKDRTLDMQCTV
TRPGVAAIAGALAVEVLVALLQHPLRIATPAVYNLNSDDLPADMQGVLGPVPHSIRGFLH
SYQTVLPTCAKFKQCIACSDAVVTKYRDEGIEFLMKVFNSGTYLEEVTGLTELHLSAEMN
DVRFFFSIREYRNMIALG
(165 a.a.)

- SilkBase 1999-2023 -