SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1270_internal:A_SariMSG_c6256_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		autophagy-related_protein_9A_[Bombyx_mori]
Ontology
GO:0000045 P autophagosome assembly
GO:0000407 C phagophore assembly site
GO:0000421 C autophagosome membrane
GO:0000422 P autophagy of mitochondrion
GO:0003674 F molecular_function
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005776 C autophagosome
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0006810 P transport
GO:0006914 P autophagy
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0032688 P negative regulation of interferon-beta production
GO:0034067 P protein localization to Golgi apparatus
GO:0034497 P protein localization to phagophore assembly site
GO:0034727 P piecemeal microautophagy of the nucleus
GO:0044805 P late nucleophagy
GO:0045087 P innate immune response
GO:0055037 C recycling endosome
RNA-seq EntryA_SariMSG_c6256_g1_i1
Sequence
(Amino Acid)
FHYLSRGLKWNLEFLLFSSPWSPWENCWQLRACYKDYSKRMLLARQLERQILLLALFNFL
FAPFIQAWQILYFFFNYAELIKRSPGSLGLRTWSLYARVTLRHFNELEHELRDRLNRAHK
PATKYLASFSSPITTVIAKNVVFLSASVLGVLVVLSVYDEDVLTVEHVLSIITIL
(57 a.a.)

- SilkBase 1999-2023 -