SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12645_complete:A_SariMSG_c25309_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_selenoprotein_S_A-like_[Amyelois_transitella]
Ontology
GO:0002865 P negative regulation of acute inflammatory response to antigenic stimulus
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005881 C cytoplasmic microtubule
GO:0005886 C plasma membrane
GO:0006111 P regulation of gluconeogenesis
GO:0006886 P intracellular protein transport
GO:0006983 P ER overload response
GO:0009749 P response to glucose
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016209 F antioxidant activity
GO:0019899 F enzyme binding
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0030970 P retrograde protein transport, ER to cytosol
GO:0032715 P negative regulation of interleukin-6 production
GO:0032720 P negative regulation of tumor necrosis factor production
GO:0032869 P cellular response to insulin stimulus
GO:0034361 C very-low-density lipoprotein particle
GO:0034362 C low-density lipoprotein particle
GO:0034599 P cellular response to oxidative stress
GO:0036502 C Derlin-1-VIMP complex
GO:0036513 C Derlin-1 retrotranslocation complex
GO:0045184 P establishment of protein localization
GO:0045454 P cell redox homeostasis
GO:0045719 P negative regulation of glycogen biosynthetic process
GO:0046325 P negative regulation of glucose import
GO:0050728 P negative regulation of inflammatory response
GO:0051117 F ATPase binding
GO:0051771 P negative regulation of nitric-oxide synthase biosynthetic process
GO:0051775 P response to redox state
GO:0071222 P cellular response to lipopolysaccharide
GO:0080164 P regulation of nitric oxide metabolic process
GO:0098869 P cellular oxidant detoxification
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1990381 F ubiquitin-specific protease binding
GO:2000110 P negative regulation of macrophage apoptotic process
RNA-seq EntryA_SariMSG_c25309_g2_i2
Sequence
(Amino Acid)
MESTGMFNPITFVGQILTMYGWYLVGGVAVLFYILNKLQPKIKAYKQAREDAEYHKDPDK
VLSRMEAIQRARERQQQLLEQSSARAREEQKQREERKRAENLERLQKYGATAAGHTLGTA
ADNDYLPLSGGASGSNYRPPKKSKCKGGGCGR
*(50 a.a.)

- SilkBase 1999-2023 -