SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12571_5prime_partial:A_SariMSG_c25273_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
regulator_of_gene_activity_isoform_X3_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000289 P nuclear-transcribed mRNA poly(A) tail shortening
GO:0000932 C P-body
GO:0001104 F transcription coregulator activity
GO:0001226 F transcription corepressor binding
GO:0001829 P trophectodermal cell differentiation
GO:0004535 F poly(A)-specific ribonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006417 P regulation of translation
GO:0006977 P DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0007275 P multicellular organism development
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0016020 C membrane
GO:0017148 P negative regulation of translation
GO:0030014 C CCR4-NOT complex
GO:0030015 C CCR4-NOT core complex
GO:0031047 P gene silencing by RNA
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:2000036 P regulation of stem cell population maintenance
RNA-seq EntryA_SariMSG_c25273_g1_i1
Sequence
(Amino Acid)
SSDLADMPCRPQDMDYHVPPEYLINGSIREKLAPLRLSRYKEDLLFYLFYCFVGDVLQIA
AAAELYNREWRYHMEEKVWISQAPGMPMVEKTSTYERGTYYFFDAHNWRKVAKEFHLDYS
KLEGRPQLPPHALT
*(44 a.a.)

- SilkBase 1999-2023 -