SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12549_5prime_partial:A_SariMSG_c25257_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_serine/threonine-protein_phosphatase_2A_activator-like_[Amyelois_transitella]
Ontology
GO:0000159 C protein phosphatase type 2A complex
GO:0000166 F nucleotide binding
GO:0000413 P protein peptidyl-prolyl isomerization
GO:0003755 F peptidyl-prolyl cis-trans isomerase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0008152 P metabolic process
GO:0008160 F protein tyrosine phosphatase activator activity
GO:0008601 F protein phosphatase regulator activity
GO:0016853 F isomerase activity
GO:0016887 F ATP hydrolysis activity
GO:0019211 F phosphatase activator activity
GO:0030472 P mitotic spindle organization
GO:0032515 P negative regulation of phosphoprotein phosphatase activity
GO:0032516 P positive regulation of phosphoprotein phosphatase activity
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0034704 C calcium channel complex
GO:0035307 P positive regulation of protein dephosphorylation
GO:0035308 P negative regulation of protein dephosphorylation
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0043666 P regulation of phosphoprotein phosphatase activity
GO:0051721 F protein phosphatase 2A binding
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariMSG_c25257_g1_i2
Sequence
(Amino Acid)
VLFRSQEDNVPTVFMIFNKYLTIARRLQKTYRMEPAGSHGVWSLDDYQFIPFIWGSAQLI
DQPKIYPPAKFLEDEIIDKYADEYMFLSCIKYIKEVKKGPFAEHSNQLWSISAVGSWTKI
NQGLIKMYKKEVLSKFPVVQHILFGSLLPIRRFPFSH
*(51 a.a.)

- SilkBase 1999-2023 -