SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12401_5prime_partial:A_SariMSG_c25175_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
tumor_susceptibility_gene_101_protein_[Spodoptera_frugiperda]
Ontology
GO:0000813 C ESCRT I complex
GO:0001558 P regulation of cell growth
GO:0003677 F DNA binding
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005771 C multivesicular body
GO:0005886 C plasma membrane
GO:0006464 P cellular protein modification process
GO:0006513 P protein monoubiquitination
GO:0006810 P transport
GO:0006914 P autophagy
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0008285 P negative regulation of cell population proliferation
GO:0008333 P endosome to lysosome transport
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016197 P endosomal transport
GO:0019058 P viral life cycle
GO:0030154 P cell differentiation
GO:0030216 P keratinocyte differentiation
GO:0030374 F nuclear receptor coactivator activity
GO:0031625 F ubiquitin protein ligase binding
GO:0031902 C late endosome membrane
GO:0036258 P multivesicular body assembly
GO:0039702 P viral budding via host ESCRT complex
GO:0040008 P regulation of growth
GO:0042803 F protein homodimerization activity
GO:0043130 F ubiquitin binding
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043405 P regulation of MAP kinase activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046755 P viral budding
GO:0046790 F virion binding
GO:0048306 F calcium-dependent protein binding
GO:0048524 P positive regulation of viral process
GO:0051301 P cell division
GO:0070062 C extracellular exosome
GO:0075733 P intracellular transport of virus
GO:0097352 P autophagosome maturation
GO:1902186 P obsolete regulation of viral release from host cell
GO:1902188 P obsolete positive regulation of viral release from host cell
GO:1903543 P positive regulation of exosomal secretion
GO:1903551 P regulation of extracellular exosome assembly
GO:1903772 P regulation of viral budding via host ESCRT complex
GO:1903774 P positive regulation of viral budding via host ESCRT complex
GO:2000397 P positive regulation of ubiquitin-dependent endocytosis
RNA-seq EntryA_SariMSG_c25175_g1_i2
Sequence
(Amino Acid)
LSLLRSFVKPTADMSIKVSKYVDSNGKVYLPYLHEWSHNGSTLQKLVQCMISAFGELPPV
YAKVRNESKPPYPVNSFMPQPSGYPYPQASPTPGYPSVTPYPTTSNLPYPSYGSPYPGSV
NTNGIPYPPASTITSYHPSSGYGPSPEAAGGTITEEHIKASLLSAVEDKLRRRLKEQSQQ
SQAELETLRRTQQELRDGKSRLEDILMRLQRERSELDKNVTILQEKEKELQAAVERLAEQ
EGVDVDEAVVTTAPLYSQLLNAFAEEATLEDAIYYMGEALRKEVIDLDTFLKQVRTLARQ
QFTLRALMHKCRQKAQLAC
*(105 a.a.)

- SilkBase 1999-2023 -