SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12395_internal:A_SariMSG_c25170_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		myosin_xv,_partial_[Biston_betularia]
Ontology
GO:0000146 F microfilament motor activity
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0005938 C cell cortex
GO:0007165 P signal transduction
GO:0007266 P Rho protein signal transduction
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016459 C myosin complex
GO:0016887 F ATP hydrolysis activity
GO:0017048 F small GTPase binding
GO:0030027 C lamellipodium
GO:0030048 P actin filament-based movement
GO:0030898 F microfilament motor activity
GO:0032011 P ARF protein signal transduction
GO:0035023 P regulation of Rho protein signal transduction
GO:0035385 P Roundabout signaling pathway
GO:0035556 P intracellular signal transduction
GO:0042803 F protein homodimerization activity
GO:0043008 F ATP-dependent protein binding
GO:0043531 F ADP binding
GO:0043547 P positive regulation of GTPase activity
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048495 F Roundabout binding
GO:0051015 F actin filament binding
GO:0051056 P regulation of small GTPase mediated signal transduction
RNA-seq EntryA_SariMSG_c25170_g1_i2
Sequence
(Amino Acid)
LHELRQLTTRVTAARAELMRSPLPIDQALDARDAFAKALYSSLFNWLVLRINSIVHRAGL
HDAHRISLLDIFGFEDLEENSFEQLCINYANETLQHYFNKHIFKLEQQEYQKE
(36 a.a.)

- SilkBase 1999-2023 -