SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12392_complete:A_SariMSG_c25169_g3_i2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_protein_smoothened_isoform_X2_[Papilio_xuthus]
Ontology
GO:0001746 P Bolwig's organ morphogenesis
GO:0002385 P mucosal immune response
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005113 F patched binding
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005929 C cilium
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007346 P regulation of mitotic cell cycle
GO:0007350 P blastoderm segmentation
GO:0007455 P eye-antennal disc morphogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017147 F Wnt-protein binding
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030707 P ovarian follicle cell development
GO:0035019 P somatic stem cell population maintenance
GO:0035567 P non-canonical Wnt signaling pathway
GO:0042813 F Wnt-activated receptor activity
GO:0042981 P regulation of apoptotic process
GO:0043025 C neuronal cell body
GO:0045746 P negative regulation of Notch signaling pathway
GO:0048099 P anterior/posterior lineage restriction, imaginal disc
GO:0048100 P wing disc anterior/posterior pattern formation
GO:0048592 P eye morphogenesis
GO:0060070 P canonical Wnt signaling pathway
GO:0090004 P positive regulation of protein localization to plasma membrane
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_SariMSG_c25169_g3_i2
Sequence
(Amino Acid)
MHKMTLRTWTYRVLLISSICHASQFDTGGDKNSISDLGYNVTDRLEIINGTPNYRLIKPD
KSTQWFPEREIKLDSCVRGARCEQLNATCLGSKLPYDKTSVHLTFYYNQNQIQNQLELYR
ELINVPNCWAVIQPLLCATFMPKCENILGRDMVYLPSYEMCKITMEPCAILYNTSYFPSF
LKCNATTFPPRCDNAVREIKFNTTGKCLPPLIRTDKLQHVYEGITGCGLPCRDPLYTEDE
HQQIHRMVGWGAGVCLALNLLTIGTFLIDWRSANKYPALVIFYINVCFAVASMGWLVQFG
IGSRDDIVCSKDGTRRQGEPSAEENLSCVVVFVLVSVFTSRVASVRNSTTPYLAVGVVRS
D
*(119 a.a.)

- SilkBase 1999-2023 -