SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12378_internal:A_SariMSG_c25167_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		nimrod_B_precursor_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005975 P carbohydrate metabolic process
GO:0007165 P signal transduction
GO:0007224 P smoothened signaling pathway
GO:0007405 P neuroblast proliferation
GO:0008270 F zinc ion binding
GO:0009887 P animal organ morphogenesis
GO:0009953 P dorsal/ventral pattern formation
GO:0009968 P negative regulation of signal transduction
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016901 F oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor
GO:0040036 P regulation of fibroblast growth factor receptor signaling pathway
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0046872 F metal ion binding
GO:0048038 F quinone binding
GO:0048705 P skeletal system morphogenesis
GO:0055114 P obsolete oxidation-reduction process
GO:0060170 C ciliary membrane
GO:0060441 P epithelial tube branching involved in lung morphogenesis
GO:0097108 F hedgehog family protein binding
RNA-seq EntryA_SariMSG_c25167_g1_i1
Sequence
(Amino Acid)
QPNYPNQPNYPNYPNQPNYPNQPYPYQPYPQPNYPNTHNEPYNPNNQPNYPNPSQYEIMV
MLPNGTITYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPC
INGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTSVKGR
AVCVKRIRR
(62 a.a.)

- SilkBase 1999-2023 -