SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12356_5prime_partial:A_SariMSG_c25157_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
fatty_acid_transport_protein,_partial_[Ascotis_selenaria_cretacea]
Ontology
GO:0000038 P very long-chain fatty acid metabolic process
GO:0000166 F nucleotide binding
GO:0001579 P medium-chain fatty acid transport
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005902 C microvillus
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0015245 F fatty acid transmembrane transporter activity
GO:0015908 P fatty acid transport
GO:0015909 P long-chain fatty acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0031526 C brush border membrane
GO:0031957 F very long-chain fatty acid-CoA ligase activity
GO:0042760 P very long-chain fatty acid catabolic process
GO:0043588 P skin development
GO:0044539 P long-chain fatty acid import into cell
RNA-seq EntryA_SariMSG_c25157_g1_i1
Sequence
(Amino Acid)
VFEHGDSAFISGDILVADELGYLYFRDRTGDTFRWRGENVSTTEVEAAISKFADQRDAVV
YGVEIPNTEGRAGMCGIVDTDGTLDLDKLAKDIAIDLPKYARPIFIRVMTSVDITGTFKM
KKVDLQKDGYNPNVVRDKLFYFDSKLDKYVPLNSEEYDKIVSGQIRL
*(55 a.a.)

- SilkBase 1999-2023 -