SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG12242_complete:A_SariMSG_c25080_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		TGF-beta_receptor_type-1_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001666 P response to hypoxia
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005025 F transforming growth factor beta receptor activity, type I
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0005923 C bicellular tight junction
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007507 P heart development
GO:0007566 P embryo implantation
GO:0007568 P aging
GO:0009636 P response to toxic substance
GO:0009986 C cell surface
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010717 P regulation of epithelial to mesenchymal transition
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030324 P lung development
GO:0031100 P animal organ regeneration
GO:0031625 F ubiquitin protein ligase binding
GO:0032403 F protein-containing complex binding
GO:0032924 P activin receptor signaling pathway
GO:0034695 P response to prostaglandin E
GO:0035556 P intracellular signal transduction
GO:0040008 P regulation of growth
GO:0042118 P endothelial cell activation
GO:0043234 C protein-containing complex
GO:0043627 P response to estrogen
GO:0045121 C membrane raft
GO:0045602 P negative regulation of endothelial cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048565 P digestive tract development
GO:0048762 P mesenchymal cell differentiation
GO:0050431 F transforming growth factor beta binding
GO:0051602 P response to electrical stimulus
GO:0060317 P cardiac epithelial to mesenchymal transition
GO:0070022 C obsolete transforming growth factor beta receptor complex
RNA-seq EntryA_SariMSG_c25080_g1_i2
Sequence
(Amino Acid)
MFLSRNVIMNTFQWRKCVLLLVFVVYRRLETVDGLKCYCNSDICPNATCVTDGYCFASTS
LVKGKQKFTYHCIELKSLIPIEHPFSCSTTKSKNESVLIKCCNAPDMCNQELPLDLEPKT
ETSTTATAWQVVPWVMGLVVFAICAAISLWWAKRWRAEVKRPPRPDEDETKHILNTPTTT
IRDMIELTTSGSGSGLPLLVQRSIARQIQLIDIIGKGRFGEVWRGRWRGENVAVKIFSSR
EECSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLITDYHENGSLFDFLTTRSI
DSNTLVKMSLSIATGLAHLHMDIVGTKGKPAIAHRDLKSKNILVKSNLTCVIGDLGLAVR
HNVTNDSVDVPTTNRVGTKRYMAPEVLEESMDSRQFDPYKRADVYSFGLVLWEMARRCGA
MPDEYQPPYYDCVAPDPSLEDMRRVVCVEKRRPIVPNRWYSELVLSSISKVMKECWYHNP
AARLTALRIKKTLANIGTPDYIKL
*(167 a.a.)

- SilkBase 1999-2023 -