SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12241_5prime_partial:A_SariMSG_c25080_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_TGF-beta_receptor_type-1_isoform_X3_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0001501 P skeletal system development
GO:0001525 P angiogenesis
GO:0001701 P in utero embryonic development
GO:0001822 P kidney development
GO:0001824 P blastocyst development
GO:0001837 P epithelial to mesenchymal transition
GO:0001937 P negative regulation of endothelial cell proliferation
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0002088 P lens development in camera-type eye
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005024 F transforming growth factor beta-activated receptor activity
GO:0005025 F transforming growth factor beta receptor activity, type I
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005102 F signaling receptor binding
GO:0005114 F type II transforming growth factor beta receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005623 C obsolete cell
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0005923 C bicellular tight junction
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007507 P heart development
GO:0008284 P positive regulation of cell population proliferation
GO:0008354 P germ cell migration
GO:0008584 P male gonad development
GO:0009791 P post-embryonic development
GO:0009952 P anterior/posterior pattern specification
GO:0009986 C cell surface
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010717 P regulation of epithelial to mesenchymal transition
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019838 F growth factor binding
GO:0023014 P signal transduction
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030199 P collagen fibril organization
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0031396 P regulation of protein ubiquitination
GO:0032331 P negative regulation of chondrocyte differentiation
GO:0032924 P activin receptor signaling pathway
GO:0035556 P intracellular signal transduction
GO:0040008 P regulation of growth
GO:0042118 P endothelial cell activation
GO:0043066 P negative regulation of apoptotic process
GO:0043235 C receptor complex
GO:0043393 P regulation of protein binding
GO:0043542 P endothelial cell migration
GO:0045121 C membrane raft
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0048538 P thymus development
GO:0048663 P neuron fate commitment
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048705 P skeletal system morphogenesis
GO:0048762 P mesenchymal cell differentiation
GO:0048844 P artery morphogenesis
GO:0048870 P cell motility
GO:0050431 F transforming growth factor beta binding
GO:0051272 P positive regulation of cellular component movement
GO:0051491 P positive regulation of filopodium assembly
GO:0051897 P positive regulation of protein kinase B signaling
GO:0060017 P parathyroid gland development
GO:0060021 P roof of mouth development
GO:0060037 P pharyngeal system development
GO:0060317 P cardiac epithelial to mesenchymal transition
GO:0060389 P pathway-restricted SMAD protein phosphorylation
GO:0060391 P positive regulation of SMAD protein signal transduction
GO:0070411 F I-SMAD binding
GO:0070723 P response to cholesterol
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:2001235 P positive regulation of apoptotic signaling pathway
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_SariMSG_c25080_g1_i1
Sequence
(Amino Acid)
DRKSVAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLITDYHENGSLFDFLTTRSIDSN
TLVKMSLSIATGLAHLHMDIVGTKGKPAIAHRDLKSKNILVKSNLTCVIGDLGLAVRHNV
TNDSVDVPTTNRVGTKRYMAPEVLEESMDSRQFDPYKRADVYSFGLVLWEMARRCGAMPD
EYQPPYYDCVAPDPSLEDMRRVVCVEKRRPIVPNRWYSELVLSSISKVMKECWYHNPAAR
LTALRIKKTLANIGTPDYIKL
*(86 a.a.)

- SilkBase 1999-2023 -