SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG12139_3prime_partial:A_SariMSG_c25016_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC101747087_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0004175 F endopeptidase activity
GO:0004222 F metalloendopeptidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005798 C Golgi-associated vesicle
GO:0005802 C trans-Golgi network
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0006508 P proteolysis
GO:0006509 P membrane protein ectodomain proteolysis
GO:0006913 P nucleocytoplasmic transport
GO:0007162 P negative regulation of cell adhesion
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007219 P Notch signaling pathway
GO:0007220 P Notch receptor processing
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0008284 P positive regulation of cell population proliferation
GO:0009986 C cell surface
GO:0010820 P positive regulation of T cell chemotaxis
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016485 P protein processing
GO:0016787 F hydrolase activity
GO:0017124 F SH3 domain binding
GO:0019901 F protein kinase binding
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0034612 P response to tumor necrosis factor
GO:0042117 P monocyte activation
GO:0042169 F SH2 domain binding
GO:0042803 F protein homodimerization activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0046872 F metal ion binding
GO:0051088 P obsolete PMA-inducible membrane protein ectodomain proteolysis
GO:0051089 P constitutive protein ectodomain proteolysis
GO:0070062 C extracellular exosome
GO:0097038 C perinuclear endoplasmic reticulum
GO:0097197 C tetraspanin-enriched microdomain
RNA-seq EntryA_SariMSG_c25016_g2_i1
Sequence
(Amino Acid)
MWLWDMWGILWAAGAVLHLVSVVATPLEPAPRIPQGLSLTPFVRHWQPAPYEPLGDHRRR
RNAPTTGPMPPQTLKFFFRAHNRDFKIVLRPDPSSVFADGVQFHSSTGQMDYNTAHVYSG
KLEDDDSSYVYGVITADGLFDGTIWTPTEEYYIEPLSRYNVDVPSMHSVIYRRSDVEHPN
DNTEAAPCASHLLHLKRTLGHEVELFNFTDQVNFMHSKSNNYTESLQSAIHRRKKRWLPE
DEMQDDEPKKNPELPLDLDVPYTSNGEHLDNKLSTRKPKTKIDKSNLITKVRLDSEESRP
KPKTHVEVIKTKAGVVTVSKDIVKKEPVGYTVLSANATDDGRHVNKRA
(115 a.a.)

- SilkBase 1999-2023 -