SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11913_5prime_partial:A_SariMSG_c24899_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
transcription_factor_A,_mitochondrial-like_[Helicoverpa_armigera]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001223 F transcription coactivator binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005829 C cytosol
GO:0006261 P DNA-dependent DNA replication
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006356 P regulation of transcription by RNA polymerase I
GO:0006366 P transcription by RNA polymerase II
GO:0006390 P mitochondrial transcription
GO:0006391 P transcription initiation from mitochondrial promoter
GO:0007005 P mitochondrion organization
GO:0008301 F DNA binding, bending
GO:0031072 F heat shock protein binding
GO:0033108 P mitochondrial respiratory chain complex assembly
GO:0042645 C mitochondrial nucleoid
GO:0044822 F RNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070363 F mitochondrial promoter sequence-specific DNA binding
RNA-seq EntryA_SariMSG_c24899_g1_i1
Sequence
(Amino Acid)
CSSDLNYTKKSAEEKLGLDKPKRPLTPFFKFIAQLRPALLAKNPGISSKEAISWTSKHWQ
QLDSETKTQMAKEYEKDLEDYRKIKAMYESSLTEQQKADIKKVKEEMAVAKEKRKLKSEF
RELGKPKRPMSSYFLYIQSRKDSIQGKGLKEYQDQVKTDWLKLPESERVKFEKQAQDLMK
KYKKDLEAWELKMVSIGRTDLIRSKPLREKKPKGSEKKQ
*(72 a.a.)

- SilkBase 1999-2023 -