SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11865_internal:A_SariMSG_c24872_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
ras-related_protein_Rab-21_[Helicoverpa_armigera]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005925 C focal adhesion
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0008089 P anterograde axonal transport
GO:0008152 P metabolic process
GO:0009898 C cytoplasmic side of plasma membrane
GO:0012506 C vesicle membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0017157 P regulation of exocytosis
GO:0019003 F GDP binding
GO:0030516 P regulation of axon extension
GO:0030659 C cytoplasmic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0032154 C cleavage furrow
GO:0032580 C Golgi cisterna membrane
GO:0043005 C neuron projection
GO:0048260 P positive regulation of receptor-mediated endocytosis
GO:0050775 P positive regulation of dendrite morphogenesis
GO:0070062 C extracellular exosome
GO:0098559 C cytoplasmic side of early endosome membrane
GO:1904115 C axon cytoplasm
GO:2000643 P positive regulation of early endosome to late endosome transport
RNA-seq EntryA_SariMSG_c24872_g1_i2
Sequence
(Amino Acid)
LFRSLKKMLGSEIIIVIAGNKIDLEHERTVPLEEAESYANLVGAKHFHTSAKLNQGVEGL
FLDLTRAMLEKHEQKITKTEDVRTSQILIIDDEEPVRTSCCS
(33 a.a.)

- SilkBase 1999-2023 -