SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG11753_5prime_partial:A_SariMSG_c24805_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Y-box_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0002039 F p53 binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0008134 F transcription factor binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008380 P RNA splicing
GO:0010494 C cytoplasmic stress granule
GO:0030425 C dendrite
GO:0030529 C ribonucleoprotein complex
GO:0043066 P negative regulation of apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0051781 P positive regulation of cell division
GO:0070934 P CRD-mediated mRNA stabilization
GO:0071204 C histone pre-mRNA 3'end processing complex
GO:1990124 C messenger ribonucleoprotein complex
RNA-seq EntryA_SariMSG_c24805_g1_i1
Sequence
(Amino Acid)
VEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYFPRQGGGRGGEGAPRRGG
LGRRGPPPNQGGAQGDEGQEGGAAPPQRSYFRRNFRGGRRGAGPGPMNRGGGGGGYRRVR
PRNFQPGQGGPNQGPRQNGQEGEAPATTSTQSQGAKPKNNKPVGTTIETTTNESQA
*(58 a.a.)

- SilkBase 1999-2023 -