SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG11660_5prime_partial:A_SariMSG_c24744_g1_i4
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_intraflagellar_transport_protein_122_homolog_[Papilio_xuthus]
Ontology
GO:0001843 P neural tube closure
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0007227 P signal transduction downstream of smoothened
GO:0007275 P multicellular organism development
GO:0009953 P dorsal/ventral pattern formation
GO:0010172 P embryonic body morphogenesis
GO:0016020 C membrane
GO:0021914 P negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning
GO:0030030 P cell projection organization
GO:0030991 C intraciliary transport particle A
GO:0032391 C photoreceptor connecting cilium
GO:0035050 P embryonic heart tube development
GO:0035115 P embryonic forelimb morphogenesis
GO:0035720 P intraciliary anterograde transport
GO:0035721 P intraciliary retrograde transport
GO:0035735 P intraciliary transport involved in cilium assembly
GO:0036064 C ciliary basal body
GO:0042384 P cilium assembly
GO:0042733 P embryonic digit morphogenesis
GO:0042995 C cell projection
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0048593 P camera-type eye morphogenesis
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0060173 P limb development
GO:0060271 P cilium assembly
GO:0060830 P ciliary receptor clustering involved in smoothened signaling pathway
GO:0060831 P smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:0060971 P embryonic heart tube left/right pattern formation
GO:0061512 P protein localization to cilium
GO:0072372 C cilium
GO:0072594 P establishment of protein localization to organelle
GO:0097542 C ciliary tip
GO:0097546 C ciliary base
RNA-seq EntryA_SariMSG_c24744_g1_i4
Sequence
(Amino Acid)
CALPIFDNDIDYTDPFLDKIDEDDESGLVICSRASLLHLNPASVIIVKRPQLRPLYYRNM
LPELPAASCPHCFNLFYLEDYEIQRVTKGHCTFCRHPADDERANDNDVDDSLLNDSTVST
PDSAINNHDSW
*(43 a.a.)

- SilkBase 1999-2023 -