SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11529_complete:A_SariMSG_c24655_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
parafibromin_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000784 C chromosome, telomeric region
GO:0000993 F RNA polymerase II complex binding
GO:0001711 P endodermal cell fate commitment
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0006378 P mRNA polyadenylation
GO:0007049 P cell cycle
GO:0008285 P negative regulation of cell population proliferation
GO:0010390 P histone monoubiquitination
GO:0016055 P Wnt signaling pathway
GO:0016570 P histone modification
GO:0016593 C Cdc73/Paf1 complex
GO:0019827 P stem cell population maintenance
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0031442 P positive regulation of mRNA 3'-end processing
GO:0031648 P protein destabilization
GO:0032968 P positive regulation of transcription elongation from RNA polymerase II promoter
GO:0033523 P histone H2B ubiquitination
GO:0045638 P negative regulation of myeloid cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048147 P negative regulation of fibroblast proliferation
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0071222 P cellular response to lipopolysaccharide
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_SariMSG_c24655_g1_i1
Sequence
(Amino Acid)
MPQPTVLPAQQTQYNRYDQERFNRQKEETEGFKIDTMGTYHGMTLKSVTEGPSVPLAARA
PQTPNHSRQMPQNGPASMGTPGRRDLLPVAAARAPAGGKRPSRTPIIIIPAAATSLISMY
NVKDMLQDLKFVTVEQKKAEGSARENEVLLQRRKGNPGDHLPTNASTITVPYRVVDNPGR
LSAAEWERVVAVFVAGPAWQFKGWPWDGNPVQIFANICAFHLKFDEIKLDGNVARWAVTV
LNLSRTKRHLDRAVLLGFWETLDKHMMKNKPHLRF
*(91 a.a.)

- SilkBase 1999-2023 -