SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11498_5prime_partial:A_SariMSG_c24627_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_flagellar_attachment_zone_protein_1_[Amyelois_transitella]
Ontology
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006810 P transport
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007294 P germarium-derived oocyte fate determination
GO:0007309 P oocyte axis specification
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007312 P oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
GO:0007314 P oocyte anterior/posterior axis specification
GO:0008103 P oocyte microtubule cytoskeleton polarization
GO:0008298 P intracellular mRNA localization
GO:0016325 P oocyte microtubule cytoskeleton organization
GO:0017137 F small GTPase binding
GO:0019233 P sensory perception of pain
GO:0030100 P regulation of endocytosis
GO:0030154 P cell differentiation
GO:0030669 C clathrin-coated endocytic vesicle membrane
GO:0030727 P germarium-derived female germ-line cyst formation
GO:0032050 F clathrin heavy chain binding
GO:0045502 F dynein complex binding
GO:0048477 P oogenesis
GO:0048488 P synaptic vesicle endocytosis
GO:0050658 P RNA transport
GO:0051028 P mRNA transport
GO:0070727 P cellular macromolecule localization
GO:2000302 P positive regulation of synaptic vesicle exocytosis
GO:2000370 P positive regulation of clathrin-dependent endocytosis
RNA-seq EntryA_SariMSG_c24627_g1_i1
Sequence
(Amino Acid)
AAEAVALALAAGELEGLRGAGQVARSADTLLDQLTHLRAALDTALDSRHRHQPVMETEER
GAELAELQEQVIKLKSLLSTKREQIATLRTVLKSNKNTAEVALANLKSKYETEKTIVTET
MLKLRNELRLLKEDAATFSSLRAMFAARCEEYVTQVDELTQSLASADEEKKTLNQLLRLA
VQQKLALTQRLEELEVDREMRTRRVPKAPGATRSRPRDF
*(72 a.a.)

- SilkBase 1999-2023 -