SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1147_5prime_partial:A_SariMSG_c5909_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_protein_Star_[Papilio_polytes]
Ontology
GO:0000042 P protein localization to Golgi apparatus
GO:0000139 C Golgi membrane
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007421 P stomatogastric nervous system development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007601 P visual perception
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016318 P ommatidial rotation
GO:0035225 P determination of genital disc primordium
GO:0038004 P epidermal growth factor receptor ligand maturation
GO:0042051 P compound eye photoreceptor development
GO:0042058 P regulation of epidermal growth factor receptor signaling pathway
GO:0045467 P R7 cell development
GO:0046667 P compound eye retinal cell programmed cell death
GO:0046845 P branched duct epithelial cell fate determination, open tracheal system
GO:0048149 P behavioral response to ethanol
GO:0048477 P oogenesis
GO:0048865 P stem cell fate commitment
GO:0050896 P response to stimulus
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
GO:0097038 C perinuclear endoplasmic reticulum
RNA-seq EntryA_SariMSG_c5909_g1_i1
Sequence
(Amino Acid)
DHPREVTYQEDDRSGSGGASSDSVFKSRVLCLPLYTVLLAADAARAEYLLLGGANALPAL
THLPFGDPGLRLQVIEVRSTDARARNKTTELLESKNYTVAASGPDGVLYTRNRDRQVPMP
IF
*(40 a.a.)

- SilkBase 1999-2023 -