SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG11347_internal:A_SariMSG_c24505_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ephrin_type-B_receptor_2_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005003 F ephrin receptor activity
GO:0005004 F GPI-linked ephrin receptor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005791 C rough endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006468 P protein phosphorylation
GO:0007162 P negative regulation of cell adhesion
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0009897 C external side of plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019933 P cAMP-mediated signaling
GO:0021766 P hippocampus development
GO:0030424 C axon
GO:0030425 C dendrite
GO:0032793 P positive regulation of CREB transcription factor activity
GO:0032956 P regulation of actin cytoskeleton organization
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043087 P regulation of GTPase activity
GO:0048013 P ephrin receptor signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0061178 P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0071372 P cellular response to follicle-stimulating hormone stimulus
GO:0071944 C cell periphery
GO:1904322 P cellular response to forskolin
RNA-seq EntryA_SariMSG_c24505_g1_i1
Sequence
(Amino Acid)
EEGAQVRLVAGVMVALVVLSVIAIIATVLFLRSRTDDECDKKQPSDCNALNYRNGEVYTG
PERPMKTSSNATTPLFAGTGSRTYIDPHTYEDPNQAVREFAREIDASCITIEAIIGGGEF
GDVCRGKLKLPASCGQEIDVAIKTLKPGSTERARRDFLAEASIMGQFEHPNVIFLQGVVT
KCNPIMIITEFMENGSLDTFLRANDGKFRVLQLVGMLRGISTGMQYLSEMNYIHRDLAAR
NVLVNSQLVCKIADFGLSRGIESTADGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSM
GIVCWEVMSFGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEAVYQLMLDCWQKERTHRPT
FASIVKTLDKLIRCPRS
(124 a.a.)

- SilkBase 1999-2023 -